PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_26.186
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family Nin-like
Protein Properties Length: 956aa    MW: 106921 Da    PI: 5.6184
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_26.186genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.92.3e-29616667152
                        RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                   aek+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GIkRWP+Rkik++
  evm.model.supercontig_26.186 616 AEKTITLQVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGIKRWPSRKIKKV 667
                                   589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.359606687IPR003035RWP-RK domain
PfamPF020422.8E-25619667IPR003035RWP-RK domain
SuperFamilySSF542776.17E-25831925No hitNo description
SMARTSM006662.7E-30841924IPR000270PB1 domain
PROSITE profilePS5174528.967841924IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.6E-24841921No hitNo description
PfamPF005641.8E-20842922IPR000270PB1 domain
CDDcd064078.33E-46843922No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 956 aa     Download sequence    Send to blast
MEDGLFPPSS MLSAPQDSTT DFDYMDELLF EGCWLETTDG SEFFTNPTPS TSTSLFDPSL  60
GWLSSDISNG IWSPSQSQII NPEERQRSLL PGNSYVNESP GRSFVNPPSL IQNIGNVNQL  120
GSYRAEVSQL SRTWWIGPKA NPGPASSVME RLGQALGYIK EFTRDKDVLI QIWVPVNRGG  180
RRVLTTSDQP FTLDPNCQSL SNYRKISVNY QFSAEEDCKD LVGLPGRVFL GKVPEWTPDV  240
RFFRSEEYLR VNHAQMWDVR GTLALPVFEQ GSRTCLGVIE VVTTSQMIKY RPELERVCKA  300
LEAVDLRSFE IPSIQNDKAC DKSYQVALPE IRDVLRCACE THRLPLAQTW VPCVQQGKGG  360
CRHSNENYVR CVSTVDDACY VADLSVQGFH EACSEYHLLK GQGVAGEAFL TNQPCFSADI  420
TSFKKTEYPL SHHARMFGLH GAVAIRLRGI HTGKADYVLE FFLPVDCIDP EGQRKMLSSL  480
SIIIQKVCRS LRVVTEKELE EETYSQTSEV IIPLDNRPSR EEMLQVECTH SEEYLRENSC  540
WTACLTEVQD SGTAASLFQN EKPRRMLEEE LLEVGQQQEN FSLKGSFKYD VGCVFNESSF  600
SSVTMSKGGE KRRVKAEKTI TLQVLRQYFA GSLKDAAKSI GVCPTTLKRI CRQHGIKRWP  660
SRKIKKVGHS LQKIQRVIDS VQGVSGPFQI GSFYANFPEL ASPKASDASP FSTSKLTSNH  720
PKPSSMMPEG RKFNSSIVAS KSPSSSCSQS SSSSHSCSSG TEQQPSIFSA TVTEDPIVVE  780
SLGDCVVKRV RSDAELHACS QEGPRLLPRS QSHISLGKQP NLESLLPLPK NSSQVSQEID  840
SQKIKVTYGD EKIRFRMQSS WSFSDLLQEI ARRFNIDDVS RFDLKYLDDD SEWVLLTCDA  900
DLEECIDIYR SSQNHTIRIS LQCVFSNVNE AVVSCLDPDN PSQDMDFLEK LLISK*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015575768.10.0PREDICTED: protein NLP4
RefseqXP_015575774.10.0PREDICTED: protein NLP4
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLA0A061FD780.0A0A061FD78_THECC; Plant regulator RWP-RK family protein, putative
STRINGPOPTR_0005s27310.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein